Crystal structure of de novo designed mid1-apo1
PDB DOI: 10.2210/pdb3v1a/pdb
Classification: DE NOVO PROTEIN, METAL BINDING PROTEIN Organism(s): Artificial Gene
Deposited: 2011-12-09 Deposition Author(s): Der, B.S. , Kuhlman, B. , Machius, M. , Miley, M.J.
Method: X-RAY DIFFRACTION Resolution: 0.98 Å
Crystal structure of de novo designed mid1-apo1
Der, B.S. , Kuhlman, B. , Machius, M. , Miley, M.J.
Primary Citation of Related Structures: 3V1A
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Computational design, MID1-apo1 | A | 48 | Artificial Gene | GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-12-09 Deposition Author(s): Der, B.S. , Kuhlman, B. , Machius, M. , Miley, M.J.