Crystal structure of the ncx1 intracellular tandem calcium binding domains(cbd12)
PDB DOI: 10.2210/pdb3us9/pdb
Classification: METAL BINDING PROTEIN Organism(s): Canis Lupus Familiaris
Deposited: 2011-11-23 Deposition Author(s): Giladi, M. , Hirsch, J.A. , Khananshvili, D. , Sasson, Y.
Crystal structure of the ncx1 intracellular tandem calcium binding domains(cbd12)
Giladi, M. , Hirsch, J.A. , Khananshvili, D. , Sasson, Y.
Primary Citation of Related Structures: 3US9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Sodium/calcium exchanger 1 | A | 295 | Canis Lupus Familiaris | MSHHHHHHVSKIFFEQGTYQCLENCGTVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGETQKEIRVGIIDDDIFEEDKNFLVHLSNVKVSSEASEDGILEANHVSALACLGSPSTATVTIFDDDHAGIFTFEEPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQNDEIVKTISVKVIDDEEYEKNKTFFLEIGEPRLVEMSEKKGGFTITEEYDDKQPLTSKEEEERRIAEMGRPILGEHTKLEVIIEESYEFKSTVD |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-11-23 Deposition Author(s): Giladi, M. , Hirsch, J.A. , Khananshvili, D. , Sasson, Y.