Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase cdelta
PDB DOI: 10.2210/pdb3uff/pdb
Classification: METAL BINDING PROTEIN Organism(s): Mus Musculus
Deposited: 2011-11-01 Deposition Author(s): Miller, K.W. , Shanmugasundararaj, S. , Stehle, T.
Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase cdelta
Miller, K.W. , Shanmugasundararaj, S. , Stehle, T.
Primary Citation of Related Structures: 3UFF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protein kinase C delta type | A | 65 | Mus Musculus | GSRRASVGSHRFKVTNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCEFIVTD |
| Protein kinase C delta type | B | 65 | Mus Musculus | GSRRASVGSHRFKVTNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCEFIVTD |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-11-01 Deposition Author(s): Miller, K.W. , Shanmugasundararaj, S. , Stehle, T.