Coiled-coil oligomerization domain of the polycystin transient receptor potential channel pkd2l1
PDB DOI: 10.2210/pdb3te3/pdb
Classification: METAL TRANSPORT Organism(s): Salmonella Enterica
Deposited: 2011-08-11 Deposition Author(s): Molland, K.M. , Yernool, D.A.
Coiled-coil oligomerization domain of the polycystin transient receptor potential channel pkd2l1
Primary Citation of Related Structures: 3TE3
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Polycystic kidney disease 2-like 1 protein | A | 39 | Salmonella Enterica | GGWVSGEEFYMLTRRVLQLETVLEGVVSQIDAVGSKLKM |
Polycystic kidney disease 2-like 1 protein | B | 39 | Salmonella Enterica | GGWVSGEEFYMLTRRVLQLETVLEGVVSQIDAVGSKLKM |
Polycystic kidney disease 2-like 1 protein | C | 39 | Salmonella Enterica | GGWVSGEEFYMLTRRVLQLETVLEGVVSQIDAVGSKLKM |
Polycystic kidney disease 2-like 1 protein | D | 39 | Salmonella Enterica | GGWVSGEEFYMLTRRVLQLETVLEGVVSQIDAVGSKLKM |
Polycystic kidney disease 2-like 1 protein | E | 39 | Salmonella Enterica | GGWVSGEEFYMLTRRVLQLETVLEGVVSQIDAVGSKLKM |
Polycystic kidney disease 2-like 1 protein | F | 39 | Salmonella Enterica | GGWVSGEEFYMLTRRVLQLETVLEGVVSQIDAVGSKLKM |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-08-11 Deposition Author(s): Molland, K.M. , Yernool, D.A.