Crystal structure of the fyve domain of endofin (zfyve16) at 1.1a resolution
PDB DOI: 10.2210/pdb3t7l/pdb
Classification: TRANSPORT PROTEIN Organism(s): Homo Sapiens
Deposited: 2011-07-30 Deposition Author(s): Arrowsmith, C.H. , Berridge, G. , Bountra, C. , Bullock, A. , Canning, P. , Chaikuad, A. , Edwards, A.M. , Guo, K. , Krojer, T. , Muniz, J.R.C. , Phillips, C. , Sanvitale, C. , Shrestha, A. , Structural Genomics Consortium (Sgc) , Von Delft, F. , Weigelt, J. , Williams, E.
Crystal structure of the fyve domain of endofin (zfyve16) at 1.1a resolution
Arrowsmith, C.H. , Berridge, G. , Bountra, C. , Bullock, A. , Canning, P. , Chaikuad, A. , Edwards, A.M. , Guo, K. , Krojer, T. , Muniz, J.R.C. , Phillips, C. , Sanvitale, C. , Shrestha, A. , Structural Genomics Consortium (Sgc) , Von Delft, F. , Weigelt, J. , Williams, E.
Primary Citation of Related Structures: 3T7L
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Zinc finger FYVE domain-containing protein 16 | A | 90 | Homo Sapiens | SMEGLVLGQKQPTWVPDSEAPNCMNCQVKFTFTKRRHHCRACGKVFCGVCCNRKCKLQYLEKEARVCVVCYETISKAQAFERMMSPTGSN |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-07-30 Deposition Author(s): Arrowsmith, C.H. , Berridge, G. , Bountra, C. , Bullock, A. , Canning, P. , Chaikuad, A. , Edwards, A.M. , Guo, K. , Krojer, T. , Muniz, J.R.C. , Phillips, C. , Sanvitale, C. , Shrestha, A. , Structural Genomics Consortium (Sgc) , Von Delft, F. , Weigelt, J. , Williams, E.