Crystal structure of the complex of cyclophilin-a enzyme from azotobacter vinelandii with sucafpfpna peptide
PDB DOI: 10.2210/pdb3t1u/pdb
Classification: ISOMERASE Organism(s): Azotobacter Vinelandii , Synthetic Construct
Deposited: 2011-07-22 Deposition Author(s): Bethanis, K. , Christoforides, E. , Dimou, M. , Karpusas, M. , Katinakis, P.
Crystal structure of the complex of cyclophilin-a enzyme from azotobacter vinelandii with sucafpfpna peptide
Bethanis, K. , Christoforides, E. , Dimou, M. , Karpusas, M. , Katinakis, P.
Primary Citation of Related Structures: 3T1U
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peptidyl-prolyl cis-trans isomerase | A | 163 | Azotobacter Vinelandii , Synthetic Construct | SIKLQTNHGTITLKLFADKAPETAANFEQYVKDGHYDGTIFHRVIDGFMIQGGGFEPGMKQKSTRAPIKNEANNGLSNKKYTIAMARTPDPHSASAQFFINVKDNAFLDHTAPTAHGWGYAVFGEVVEGTDVVDRIKSVATGSRAGHGDVPVDDVIIEKAEIV |
| succinyl-Ala-Phe-Pro-Phe-p-nitroanilide | B | 6 | Azotobacter Vinelandii , Synthetic Construct | XAFPFX |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-07-22 Deposition Author(s): Bethanis, K. , Christoforides, E. , Dimou, M. , Karpusas, M. , Katinakis, P.