Crystal structure of wild-type hiv-1 protease with c3-substituted hexahydrocyclopentafuranyl urethane as p2-ligand, grl-0489a
PDB DOI: 10.2210/pdb3st5/pdb
Classification: HYDROLASE/HYDROLASE INHIBITOR Organism(s): Human Immunodeficiency Virus Type 1
Deposited: 2011-07-08 Deposition Author(s): Agniswamy, J. , Wang, Y.-F. , Weber, I.T.
Crystal structure of wild-type hiv-1 protease with c3-substituted hexahydrocyclopentafuranyl urethane as p2-ligand, grl-0489a
Agniswamy, J. , Wang, Y.-F. , Weber, I.T.
Primary Citation of Related Structures: 3ST5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protease | A | 99 | Human Immunodeficiency Virus Type 1 | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF |
| Protease | B | 99 | Human Immunodeficiency Virus Type 1 | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-07-08 Deposition Author(s): Agniswamy, J. , Wang, Y.-F. , Weber, I.T.