Crystal structure of the ldl receptor tail in complex with autosomal recessive hypercholesterolemia ptb domain
PDB DOI: 10.2210/pdb3so6/pdb
Classification: PROTEIN BINDING/PROTEIN TRANSPORT Organism(s): Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2011-06-29 Deposition Author(s): Dvir, H. , Zajonc, D.M.
Crystal structure of the ldl receptor tail in complex with autosomal recessive hypercholesterolemia ptb domain
Primary Citation of Related Structures: 3SO6
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
LDL receptor adaptor protein | A | 137 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MEGMVFSLKYLGMTLVERPKGEELSAAAVKRIVATAKASGKKLQKVTLKVSPRGIILTDSLTSQLIENVSIYRISYCTADKMHDKVFAYIAQSQQNESLECHAFLCTKRKVAQAVTLTVAQAFKVAFEFWQVSLVPR |
Low-density lipoprotein receptor | Q | 14 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | NSINFDNPVYQKTT |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-06-29 Deposition Author(s): Dvir, H. , Zajonc, D.M.