The crystal structure of xmrv protease complexed with amprenavir
PDB DOI: 10.2210/pdb3sm2/pdb
Classification: hydrolase/hydrolase inhibitor Organism(s): Dg-75 Murine Leukemia Virus
Deposited: 2011-06-27 Deposition Author(s): Gustchina, A. , Li, M. , Wlodawer, A.
The crystal structure of xmrv protease complexed with amprenavir
Gustchina, A. , Li, M. , Wlodawer, A.
Primary Citation of Related Structures: 3SM2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| gag-pro-pol polyprotein | A | 132 | Dg-75 Murine Leukemia Virus | MHHHHHHTLGDQGGQGQEPPPEPRITLKVGGQPVTFLVDTGAQHSVLTQNPGPLSDKSAWVQGATGGKRYRWTTDRKVHLATGKVTHSFLHVPDCPYPLLGRDLLTKLKAQIHFEGSGAQVVGPMGQPLQVL |
| gag-pro-pol polyprotein | B | 132 | Dg-75 Murine Leukemia Virus | MHHHHHHTLGDQGGQGQEPPPEPRITLKVGGQPVTFLVDTGAQHSVLTQNPGPLSDKSAWVQGATGGKRYRWTTDRKVHLATGKVTHSFLHVPDCPYPLLGRDLLTKLKAQIHFEGSGAQVVGPMGQPLQVL |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-06-27 Deposition Author(s): Gustchina, A. , Li, M. , Wlodawer, A.