Crystal structure of phenazine resistance protein ehpr from enterobacter agglomerans (erwinia herbicola, pantoea agglomerans) eh1087 in complex with griseoluteic acid
PDB DOI: 10.2210/pdb3sk2/pdb
Classification: GRISEOLUTEATE-BINDING PROTEIN Organism(s): Pantoea Agglomerans
Deposited: 2011-06-22 Deposition Author(s): Blankenfeldt, W. , Yu, S.
Crystal structure of phenazine resistance protein ehpr from enterobacter agglomerans (erwinia herbicola, pantoea agglomerans) eh1087 in complex with griseoluteic acid
Primary Citation of Related Structures: 3SK2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| EhpR | A | 132 | Pantoea Agglomerans | GSHMTDLAGPTITPNLQLVYVSNVERSTDFYRFIFKKEPVFVTPRYVAFPSSGDALFAIWSGGEEPVAEIPRFSEIGIMLPTGEDVDKLFNEWTKQKSHQIIVIKEPYTDVFGRTFLISDPDGHIIRVCPLD |
| EhpR | B | 132 | Pantoea Agglomerans | GSHMTDLAGPTITPNLQLVYVSNVERSTDFYRFIFKKEPVFVTPRYVAFPSSGDALFAIWSGGEEPVAEIPRFSEIGIMLPTGEDVDKLFNEWTKQKSHQIIVIKEPYTDVFGRTFLISDPDGHIIRVCPLD |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-06-22 Deposition Author(s): Blankenfeldt, W. , Yu, S.