Crystal structure of ure3-binding protein, wild-type
PDB DOI: 10.2210/pdb3sib/pdb
Classification: DNA BINDING PROTEIN Organism(s): Entamoeba Histolytica
Deposited: 2011-06-17 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Crystal structure of ure3-binding protein, wild-type
Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Primary Citation of Related Structures: 3SIB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| URE3-BP sequence specific DNA binding protein | A | 220 | Entamoeba Histolytica | MQPPVANFCLWNLQPIQGSWMGAACIYQMPPSVRNTWWFPLLNTIPLDQYTRIYQWFMGVDRDRSGTLEINELMMGQFPGGIRLSPQTALRMMRIFDTDFNGHISFYEFMAMYKFMELAYNLFVMNDRNRSGTLEPHEILPALQQLGFYINQRTSLLLHRLFARGMAFCDLNCWIAICAFAAQTRSAYQMIFMNPYYGPMKPFNPMEFGKFLDVVTSLLE |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-06-17 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)