Structures of product and inhibitor complexes of streptomyces griseus protease a at 1.8 angstroms resolution. a model for serine protease catalysis
PDB DOI: 10.2210/pdb3sga/pdb
Classification: HYDROLASE/HYDROLASE INHIBITOR Organism(s): Streptomyces Griseus , Synthetic Construct
Deposited: 1990-05-29 Deposition Author(s): James, M.N.G. , Sielecki, A.R.
Structures of product and inhibitor complexes of streptomyces griseus protease a at 1.8 angstroms resolution. a model for serine protease catalysis
James, M.N.G. , Sielecki, A.R.
Primary Citation of Related Structures: 3SGA
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PROTEINASE A (SGPA) | E | 181 | Streptomyces Griseus , Synthetic Construct | IAGGEAITTGGSRCSLGFNVSVNGVAHALTAGHCTNISASWSIGTRTGTSFPNNDYGIIRHSNPAAADGRVYLYNGSYQDITTAGNAFVGQAVQRSGSTTGLRSGSVTGLNATVNYGSSGIVYGMIQTNVCAQPGDSGGSLFAGSTALGLTSGGSGNCRTGGTTFYQPVTEALSAYGATVL |
| ACE-PRO-ALA-PRO-PHE-ALDEHYDE | P | 5 | Streptomyces Griseus , Synthetic Construct | XPAPF |
Method: X-RAY DIFFRACTION
Deposited Date: 1990-05-29 Deposition Author(s): James, M.N.G. , Sielecki, A.R.