Crystal structure of mouse apolipoprotein a-i binding protein in complex with theophylline
PDB DOI: 10.2210/pdb3rox/pdb
Classification: PROTEIN BINDING Organism(s): Mus Musculus
Deposited: 2011-04-26 Deposition Author(s): Cymborowski, M. , Herr, J.C. , Jha, K.N. , Minor, W. , Shumilin, I.A.
Crystal structure of mouse apolipoprotein a-i binding protein in complex with theophylline
Cymborowski, M. , Herr, J.C. , Jha, K.N. , Minor, W. , Shumilin, I.A.
Primary Citation of Related Structures: 3ROX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Apolipoprotein A-I-binding protein | A | 265 | Mus Musculus | MQQSVCRARPIWWGTQRRGSETMAGAAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPTVLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMVDELYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRLQHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-04-26 Deposition Author(s): Cymborowski, M. , Herr, J.C. , Jha, K.N. , Minor, W. , Shumilin, I.A.