Crystal structure of the sh3 domain from irsp53 (baiap2)
PDB DOI: 10.2210/pdb3rnj/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens
Deposited: 2011-04-22 Deposition Author(s): Arrowsmith, C.H. , Barilari, M. , Bountra, C. , Chaikuad, A. , Dente, L. , Edwards, A.M. , Feller, S.M. , Filippakopoulos, P. , Knapp, S. , Muniz, J.R.C. , Raynor, J. , Simister, P.C. , Structural Genomics Consortium (Sgc) , Tregubova, A. , Vollmar, M. , Von Delft, F. , Weigelt, J.
Crystal structure of the sh3 domain from irsp53 (baiap2)
Arrowsmith, C.H. , Barilari, M. , Bountra, C. , Chaikuad, A. , Dente, L. , Edwards, A.M. , Feller, S.M. , Filippakopoulos, P. , Knapp, S. , Muniz, J.R.C. , Raynor, J. , Simister, P.C. , Structural Genomics Consortium (Sgc) , Tregubova, A. , Vollmar, M. , Von Delft, F. , Weigelt, J.
Primary Citation of Related Structures: 3RNJ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Brain-specific angiogenesis inhibitor 1-associated protein 2 | A | 67 | Homo Sapiens | GPLGSGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTKMRGWFPFSYTRVLD |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-04-22 Deposition Author(s): Arrowsmith, C.H. , Barilari, M. , Bountra, C. , Chaikuad, A. , Dente, L. , Edwards, A.M. , Feller, S.M. , Filippakopoulos, P. , Knapp, S. , Muniz, J.R.C. , Raynor, J. , Simister, P.C. , Structural Genomics Consortium (Sgc) , Tregubova, A. , Vollmar, M. , Von Delft, F. , Weigelt, J.