Nmr structure of the n-terminal domain with a linker portion of antarctic eel pout antifreeze protein rd3, minimized average structure
PDB DOI: 10.2210/pdb3rdn/pdb
Classification: ANTIFREEZE Organism(s): Lycodichthys Dearborni
Deposited: 1998-02-24 Deposition Author(s): Hikichi, K. , Hoshino, T. , Miura, K. , Nemoto, N. , Ohgiya, S. , Tsuda, S.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of the n-terminal domain with a linker portion of antarctic eel pout antifreeze protein rd3, minimized average structure
Hikichi, K. , Hoshino, T. , Miura, K. , Nemoto, N. , Ohgiya, S. , Tsuda, S.
Primary Citation of Related Structures: 3RDN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ANTIFREEZE PROTEIN RD3 TYPE III | A | 74 | Lycodichthys Dearborni | MNKASVVANQLIPINTALTLIMMKAEVVTPMGIPAEEIPNLVGMQVNRAVPLGTTLMPDMVKNYEDGTTSPGLK |
Method: SOLUTION NMR
Deposited Date: 1998-02-24 Deposition Author(s): Hikichi, K. , Hoshino, T. , Miura, K. , Nemoto, N. , Ohgiya, S. , Tsuda, S.