The crystal structure of thioredoxin-related protein from neisseria meningitidis serogroup b
PDB DOI: 10.2210/pdb3raz/pdb
Classification: OXIDOREDUCTASE Organism(s): Neisseria Meningitidis Serogroup B
Deposited: 2011-03-28 Deposition Author(s): Burley, S.K. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Swaminathan, S. , Zhang, Z.
The crystal structure of thioredoxin-related protein from neisseria meningitidis serogroup b
Burley, S.K. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Swaminathan, S. , Zhang, Z.
Primary Citation of Related Structures: 3RAZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Thioredoxin-related protein | A | 151 | Neisseria Meningitidis Serogroup B | MSLSADELAGWKDNTPQSLQSLKAPVRIVNLWATWCGPCRKEMPAMSKWYKAQKKGSVDMVGIALDTSDNIGNFLKQTPVSYPIWRYTGANSRNFMKTYGNTVGVLPFTVVEAPKCGYRQTITGEVNEKSLTDAVKLAHSKCREGHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-03-28 Deposition Author(s): Burley, S.K. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Swaminathan, S. , Zhang, Z.