Rat catechol o-methyltransferase in complex with the bisubstrate inhibitor 4'-fluoro-4,5-dihydroxy-biphenyl-3-carboxylic acid {(e)-3-[(2s,4r,5r)-4-hydroxy-5-(6-methyl-purin-9-yl)-tetrahydro-furan-2-yl]-allyl}-amide
PDB DOI: 10.2210/pdb3r6t/pdb
Classification: TRANSFERASE/TRANSFERASE INHIBITOR Organism(s): Rattus Norvegicus
Deposited: 2011-03-22 Deposition Author(s): Benz, J. , Ehler, A. , Rudolph, M.G. , Schlatter, D. , Stihle, M.
Rat catechol o-methyltransferase in complex with the bisubstrate inhibitor 4'-fluoro-4,5-dihydroxy-biphenyl-3-carboxylic acid {(e)-3-[(2s,4r,5r)-4-hydroxy-5-(6-methyl-purin-9-yl)-tetrahydro-furan-2-yl]-allyl}-amide
Benz, J. , Ehler, A. , Rudolph, M.G. , Schlatter, D. , Stihle, M.
Primary Citation of Related Structures: 3R6T
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Catechol O-methyltransferase | A | 221 | Rattus Norvegicus | MGDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDKS |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-03-22 Deposition Author(s): Benz, J. , Ehler, A. , Rudolph, M.G. , Schlatter, D. , Stihle, M.