Molecular analysis of the interaction of the hdl-receptor sr-bi with the pdz3 domain of its adaptor protein pdzk1
PDB DOI: 10.2210/pdb3r69/pdb
Classification: SIGNALING PROTEIN Organism(s): Mus Musculus
Deposited: 2011-03-21 Deposition Author(s): Birrane, G. , Kocher, O. , Krieger, M.
Molecular analysis of the interaction of the hdl-receptor sr-bi with the pdz3 domain of its adaptor protein pdzk1
Birrane, G. , Kocher, O. , Krieger, M.
Primary Citation of Related Structures: 3R69
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Na(+)/H(+) exchange regulatory cofactor NHE-RF3, Scavenger receptor class B member 1 | A | 89 | Mus Musculus | GSPRVVVIKKGSNGYGFYLRAGPEQKGQIIKDIEPGSPAEAAGLKNNDLVVAVNGKSVEALDHDGVVEMIRKGGDQTTLLVLDKQEAKL |
| Na(+)/H(+) exchange regulatory cofactor NHE-RF3, Scavenger receptor class B member 1 | B | 89 | Mus Musculus | GSPRVVVIKKGSNGYGFYLRAGPEQKGQIIKDIEPGSPAEAAGLKNNDLVVAVNGKSVEALDHDGVVEMIRKGGDQTTLLVLDKQEAKL |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-03-21 Deposition Author(s): Birrane, G. , Kocher, O. , Krieger, M.