Crystal structure of the p93a monomer mutant of s. cerevisiae cks1
PDB DOI: 10.2210/pdb3qy2/pdb
Classification: TRANSFERASE REGULATOR Organism(s): Saccharomyces Cerevisiae
Deposited: 2011-03-02 Deposition Author(s): Balog, E.R.M. , Finch, W. , Harvey, S.L. , Hoeft, C.O. , Kellogg, D.K. , Rubin, S.M. , Saetern, O.C. , Thai, V.
Crystal structure of the p93a monomer mutant of s. cerevisiae cks1
Balog, E.R.M. , Finch, W. , Harvey, S.L. , Hoeft, C.O. , Kellogg, D.K. , Rubin, S.M. , Saetern, O.C. , Thai, V.
Primary Citation of Related Structures: 3QY2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cyclin-dependent kinases regulatory subunit | A | 117 | Saccharomyces Cerevisiae | MYHHYHAFQGRKLTDQERARVLEFQDSIHYSPRYSDDNYEYRHVMLPKAMLKVIPSDYFNSEVGTLRILTEDEWRGLGITQSLGWEHYECHAAEPHILLFKRPLNYEAELRAATAAA |
| Cyclin-dependent kinases regulatory subunit | B | 117 | Saccharomyces Cerevisiae | MYHHYHAFQGRKLTDQERARVLEFQDSIHYSPRYSDDNYEYRHVMLPKAMLKVIPSDYFNSEVGTLRILTEDEWRGLGITQSLGWEHYECHAAEPHILLFKRPLNYEAELRAATAAA |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-03-02 Deposition Author(s): Balog, E.R.M. , Finch, W. , Harvey, S.L. , Hoeft, C.O. , Kellogg, D.K. , Rubin, S.M. , Saetern, O.C. , Thai, V.