Crystal structure of a putative uncharacterized protein and possible molybdenum cofactor protein from mycobacterium smegmatis
PDB DOI: 10.2210/pdb3qua/pdb
Classification: UNKNOWN FUNCTION Organism(s): Mycobacterium Smegmatis Str. Mc2 155
Deposited: 2011-02-23 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Crystal structure of a putative uncharacterized protein and possible molybdenum cofactor protein from mycobacterium smegmatis
Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Primary Citation of Related Structures: 3QUA
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Putative uncharacterized protein | A | 199 | Mycobacterium Smegmatis Str. Mc2 155 | GPGSMVVARVYVGDVKEGQDRQWAVCVYCASGPTHPELLELAAEVGSSIAARGWTLVSGGGNVSAMGAVAQAARAKGGHTVGVIPKALVHRELADVDAAELIVTDTMRERKREMEHRSDAFIALPGGIGTLEEFFEAWTAGYLGMHDKPLILLDPFGHYDGLLTWLRGLVPTGYVSQRAMDSLVVVDNVEAALEACAPE |
| Putative uncharacterized protein | B | 199 | Mycobacterium Smegmatis Str. Mc2 155 | GPGSMVVARVYVGDVKEGQDRQWAVCVYCASGPTHPELLELAAEVGSSIAARGWTLVSGGGNVSAMGAVAQAARAKGGHTVGVIPKALVHRELADVDAAELIVTDTMRERKREMEHRSDAFIALPGGIGTLEEFFEAWTAGYLGMHDKPLILLDPFGHYDGLLTWLRGLVPTGYVSQRAMDSLVVVDNVEAALEACAPE |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-02-23 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)