Hiv-1 protease (mutant q7k l33i l63i) in complex with a three-armed pyrrolidine-based inhibitor
PDB DOI: 10.2210/pdb3qpj/pdb
Classification: HYDROLASE/HYDROLASE INHIBITOR Organism(s): Human Immunodeficiency Virus Type 1 (Bru Isolate)
Deposited: 2011-02-14 Deposition Author(s): Heine, A. , Klebe, G. , Lindemann, I.
Hiv-1 protease (mutant q7k l33i l63i) in complex with a three-armed pyrrolidine-based inhibitor
Heine, A. , Klebe, G. , Lindemann, I.
Primary Citation of Related Structures: 3QPJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protease | A | 99 | Human Immunodeficiency Virus Type 1 (Bru Isolate) | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
| Protease | B | 99 | Human Immunodeficiency Virus Type 1 (Bru Isolate) | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-02-14 Deposition Author(s): Heine, A. , Klebe, G. , Lindemann, I.