Structural insights for mpp8 chromodomain interaction with histone h3 lysine 9
PDB DOI: 10.2210/pdb3qo2/pdb
Classification: DNA BINDING PROTEIN/GENE REGULATION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2011-02-09 Deposition Author(s): Bedford, M.T. , Chang, Y. , Cheng, X. , Horton, J.R. , Zhang, X.
Method: X-RAY DIFFRACTION Resolution: 2.49 Å
Structural insights for mpp8 chromodomain interaction with histone h3 lysine 9
Bedford, M.T. , Chang, Y. , Cheng, X. , Horton, J.R. , Zhang, X.
Primary Citation of Related Structures: 3QO2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| M-phase phosphoprotein 8 | A | 64 | Homo Sapiens , Synthetic Construct | HMGEDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENKAK |
| M-phase phosphoprotein 8 | B | 64 | Homo Sapiens , Synthetic Construct | HMGEDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENKAK |
| M-phase phosphoprotein 8 | C | 64 | Homo Sapiens , Synthetic Construct | HMGEDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENKAK |
| M-phase phosphoprotein 8 | D | 64 | Homo Sapiens , Synthetic Construct | HMGEDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENKAK |
| Histone H3 peptide | P | 15 | Homo Sapiens , Synthetic Construct | ARTKQTARKSTGGKA |
| Histone H3 peptide | Q | 15 | Homo Sapiens , Synthetic Construct | ARTKQTARKSTGGKA |
| Histone H3 peptide | R | 15 | Homo Sapiens , Synthetic Construct | ARTKQTARKSTGGKA |
| Histone H3 peptide | S | 15 | Homo Sapiens , Synthetic Construct | ARTKQTARKSTGGKA |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-02-09 Deposition Author(s): Bedford, M.T. , Chang, Y. , Cheng, X. , Horton, J.R. , Zhang, X.