Crystal structure of hiv-1 rnase h with engineered e. coli loop and n-hydroxy quinazolinedione inhibitor
PDB DOI: 10.2210/pdb3qio/pdb
Classification: TRANSFERASE, HYDROLASE/INHIBITOR Organism(s): Escherichia Coli (Strain K12) , Human Immunodeficiency Virus Type 1 Group M Subtype B , Human Immunodeficiency Virus Type 1 Group M Subtype B (Isolate Hxb2)
Deposited: 2011-01-27 Deposition Author(s): Lansdon, E.B. , Liu, Q.
Crystal structure of hiv-1 rnase h with engineered e. coli loop and n-hydroxy quinazolinedione inhibitor
Primary Citation of Related Structures: 3QIO
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Gag-Pol polyprotein,Ribonuclease HI,Gag-Pol polyprotein | A | 150 | Escherichia Coli (Strain K12) , Human Immunodeficiency Virus Type 1 Group M Subtype B , Human Immunodeficiency Virus Type 1 Group M Subtype B (Isolate Hxb2) | MYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIITQWIHNWKKRGWKTADKKPVKNVDLVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVLF |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-01-27 Deposition Author(s): Lansdon, E.B. , Liu, Q.