Crystal structure of pdz domain of sorting nexin 27 (snx27) fused to the gly-gly linker followed by c-terminal (eseskv) of girk3
PDB DOI: 10.2210/pdb3qdo/pdb
Classification: PROTEIN BINDING Organism(s): Rattus Norvegicus
Deposited: 2011-01-18 Deposition Author(s): Balana, B. , Choe, S. , Kwiatkowski, W.
Crystal structure of pdz domain of sorting nexin 27 (snx27) fused to the gly-gly linker followed by c-terminal (eseskv) of girk3
Balana, B. , Choe, S. , Kwiatkowski, W.
Primary Citation of Related Structures: 3QDO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Sorting nexin-27, G protein-activated inward rectifier potassium channel 3 chimera | A | 109 | Rattus Norvegicus | GSHGGSPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGAADRAGVRKGDRILEVNGVNVEGATHKQVVDLIRAGEKELILTVLSVGGESESKV |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-01-18 Deposition Author(s): Balana, B. , Choe, S. , Kwiatkowski, W.