Crystal structure of the pwwp domain of human hepatoma-derived growth factor 2
PDB DOI: 10.2210/pdb3qby/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2011-01-14 Deposition Author(s): Adams-Cioaba, M.A. , Amaya, M.F. , Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Mackenzie, F. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Weigelt, J. , Wu, H. , Zeng, H.
Crystal structure of the pwwp domain of human hepatoma-derived growth factor 2
Adams-Cioaba, M.A. , Amaya, M.F. , Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Mackenzie, F. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Weigelt, J. , Wu, H. , Zeng, H.
Primary Citation of Related Structures: 3QBY
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Hepatoma-derived growth factor-related protein 2 | A | 94 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GMPHAFKPGDLVFAKMKGYPHWPARIDDIADGAVKPPPNKYPIFFFGTHETAFLGPKDLFPYDKCKDKYGKPNKRKGFNEGLWEIQNNPHASYS |
Hepatoma-derived growth factor-related protein 2 | B | 94 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GMPHAFKPGDLVFAKMKGYPHWPARIDDIADGAVKPPPNKYPIFFFGTHETAFLGPKDLFPYDKCKDKYGKPNKRKGFNEGLWEIQNNPHASYS |
Hepatoma-derived growth factor-related protein 2 | C | 94 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GMPHAFKPGDLVFAKMKGYPHWPARIDDIADGAVKPPPNKYPIFFFGTHETAFLGPKDLFPYDKCKDKYGKPNKRKGFNEGLWEIQNNPHASYS |
H4K20me3 Histone H4 Peptide | H | 11 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AKRHRKVLRDN |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-01-14 Deposition Author(s): Adams-Cioaba, M.A. , Amaya, M.F. , Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Mackenzie, F. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Weigelt, J. , Wu, H. , Zeng, H.