Crystal structure of anopheles gambiae odorant binding protein 4 in complex with indole
PDB DOI: 10.2210/pdb3q8i/pdb
Classification: Odorant Binding Protein Organism(s): Anopheles Gambiae
Deposited: 2011-01-06 Deposition Author(s): Davrazou, F. , Dong, E. , Jones, D.N.M. , Murphy, E.J.
Crystal structure of anopheles gambiae odorant binding protein 4 in complex with indole
Davrazou, F. , Dong, E. , Jones, D.N.M. , Murphy, E.J.
Primary Citation of Related Structures: 3Q8I
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Odorant binding protein | A | 124 | Anopheles Gambiae | MTMKQLTNSMDMMRQACAPKFKVEEAELHGLRKSIFPANPDKELKCYAMCIAQMAGTMTKKGEISFSKTMAQIEAMLPPEMKTMAKEALTHCKDTQTSYKDPCDKAYFSAKCAADFTPDTFMFP |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-01-06 Deposition Author(s): Davrazou, F. , Dong, E. , Jones, D.N.M. , Murphy, E.J.