Crystal structure of masp-1 cub2 domain in complex with the collagen-like domain of mbl
PDB DOI: 10.2210/pdb3pob/pdb
Classification: HYDROLASE Organism(s): Rattus Norvegicus , Synthetic Construct
Deposited: 2010-11-22 Deposition Author(s): Gingras, A.R. , Moody, P.C.E. , Wallis, R.
Crystal structure of masp-1 cub2 domain in complex with the collagen-like domain of mbl
Gingras, A.R. , Moody, P.C.E. , Wallis, R.
Primary Citation of Related Structures: 3POB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence | 
| Mannan-binding lectin serine protease 1 | A | 115 | Rattus Norvegicus , Synthetic Construct | MVECSGNLFTQRTGTITSPDYPNPYPKSSECSYTIDLEEGFMVTLQFEDIFDIEDHPEVPCPYDYIKIKAGSKVWGPFCGEKSPEPISTQSHSIQILFRSDNSGENRGWRLSYRA | 
| MBL collagen-like peptide | B | 29 | Rattus Norvegicus , Synthetic Construct | XGPPGPPGPPGPPGKLGPPGPPGPPGPPX | 
| MBL collagen-like peptide | C | 29 | Rattus Norvegicus , Synthetic Construct | XGPPGPPGPPGPPGKLGPPGPPGPPGPPX | 
| MBL collagen-like peptide | D | 29 | Rattus Norvegicus , Synthetic Construct | XGPPGPPGPPGPPGKLGPPGPPGPPGPPX | 
Method: X-RAY DIFFRACTION
Deposited Date: 2010-11-22 Deposition Author(s): Gingras, A.R. , Moody, P.C.E. , Wallis, R.
 
                  