3POB
Crystal structure of masp-1 cub2 domain in complex with the collagen-like domain of mbl
PDB DOI: 10.2210/pdb3pob/pdb
Classification: HYDROLASE Organism(s): Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2010-11-22 Deposition Author(s): Gingras, A.R. , Moody, P.C.E. , Wallis, R.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.801 Å
Crystal structure of masp-1 cub2 domain in complex with the collagen-like domain of mbl
Gingras, A.R. , Moody, P.C.E. , Wallis, R.
Primary Citation of Related Structures: 3POB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Mannan-binding lectin serine protease 1 | A | 115 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MVECSGNLFTQRTGTITSPDYPNPYPKSSECSYTIDLEEGFMVTLQFEDIFDIEDHPEVPCPYDYIKIKAGSKVWGPFCGEKSPEPISTQSHSIQILFRSDNSGENRGWRLSYRA |
| MBL collagen-like peptide | B | 29 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XGPPGPPGPPGPPGKLGPPGPPGPPGPPX |
| MBL collagen-like peptide | C | 29 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XGPPGPPGPPGPPGKLGPPGPPGPPGPPX |
| MBL collagen-like peptide | D | 29 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XGPPGPPGPPGPPGKLGPPGPPGPPGPPX |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2010-11-22 Deposition Author(s): Gingras, A.R. , Moody, P.C.E. , Wallis, R.