Crystal structure of bs-cspb in complex with ru6
PDB DOI: 10.2210/pdb3pf5/pdb
Classification: GENE REGULATION/RNA Organism(s): Bacillus Subtilis , Synthetic Construct
Deposited: 2010-10-27 Deposition Author(s): Heinemann, U. , Max, K.E.A. , Sachs, R.
Crystal structure of bs-cspb in complex with ru6
Heinemann, U. , Max, K.E.A. , Sachs, R.
Primary Citation of Related Structures: 3PF5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cold shock protein cspB | A | 67 | Bacillus Subtilis , Synthetic Construct | MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA |
| Cold shock protein cspB | B | 67 | Bacillus Subtilis , Synthetic Construct | MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-10-27 Deposition Author(s): Heinemann, U. , Max, K.E.A. , Sachs, R.