Structure of greyhound hemoglobin: origin of high oxygen affinity
PDB DOI: 10.2210/pdb3pel/pdb
Classification: OXYGEN TRANSPORT Organism(s): Canis Lupus Familiaris
Deposited: 2010-10-26 Deposition Author(s): Bhatt, V.S. , Couto, C.G. , Harris, D.R. , Palmer, A.F. , Wang, P.G. , Zaldivar-Lopez, S.
Structure of greyhound hemoglobin: origin of high oxygen affinity
Bhatt, V.S. , Couto, C.G. , Harris, D.R. , Palmer, A.F. , Wang, P.G. , Zaldivar-Lopez, S.
Primary Citation of Related Structures: 3PEL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Hemoglobin subunit alpha | A | 141 | Canis Lupus Familiaris | VLSPADKTNIKSTWDKIGGHAGDYGGEALDRTFQSFPTTKTYFPHFDLSPGSAQVKAHGKKVADALTTAVAHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPTEFTPAVHASLDKFFAAVSTVLTSKYR |
| Hemoglobin subunit beta | B | 146 | Canis Lupus Familiaris | VHLTAEEKSLVSGLWGKVNVDEVGGEALGRLLIVYPWTQRFFDSFGDLSTPDAVMSNAKVKAHGKKVLNSFSDGLKNLDNLKGTFAKLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPQVQAAYQKVVAGVANALAHKYH |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-10-26 Deposition Author(s): Bhatt, V.S. , Couto, C.G. , Harris, D.R. , Palmer, A.F. , Wang, P.G. , Zaldivar-Lopez, S.