Peptidase module of the peptidoglycan hydrolase ripa (rv1477) from mycobacterium tuberculosis at 1.38 resolution
PDB DOI: 10.2210/pdb3pbc/pdb
Classification: HYDROLASE Organism(s): Mycobacterium Tuberculosis
Deposited: 2010-10-20 Deposition Author(s): Both, D. , Schneider, G. , Schnell, R.
Peptidase module of the peptidoglycan hydrolase ripa (rv1477) from mycobacterium tuberculosis at 1.38 resolution
Both, D. , Schneider, G. , Schnell, R.
Primary Citation of Related Structures: 3PBC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| INVASION PROTEIN | A | 214 | Mycobacterium Tuberculosis | SGRAWDGLWDPTLPMIPSANIPGDPIAVVNQVLGISATSAQVTANMGRKFLEQLGILQPTDTGITNAPAGSAQGRIPRVYGRQASEYVIRRGMSQIGVPYSWGGGNAAGPSKGIDSGAGTVGFDCSGLVLYSFAGVGIKLPHYSGSQYNLGRKIPSSQMRRGDVIFYGPNGSQHVTIYLGNGQMLEAPDVGLKVRVAPVRTAGMTPYVVRYIEY |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-10-20 Deposition Author(s): Both, D. , Schneider, G. , Schnell, R.