Crystal structure of thioredoxin 2 from yersinia pestis
PDB DOI: 10.2210/pdb3p2a/pdb
Classification: OXIDOREDUCTASE Organism(s): Yersinia Pestis
Deposited: 2010-10-01 Deposition Author(s): Anderson, W.F. , Center For Structural Genomics Of Infectious Diseases (Csgid) , Grimshaw, S. , Joachimiak, A. , Kim, Y. , Zhou, M.
Crystal structure of thioredoxin 2 from yersinia pestis
Anderson, W.F. , Center For Structural Genomics Of Infectious Diseases (Csgid) , Grimshaw, S. , Joachimiak, A. , Kim, Y. , Zhou, M.
Primary Citation of Related Structures: 3P2A
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Putative thioredoxin-like protein | A | 148 | Yersinia Pestis | SNAMNTVCTACMATNRLPEERIDDGAKCGRCGHSLFDGEVINATAETLDKLLQDDLPMVIDFWAPWCGPCRSFAPIFAETAAERAGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMIDMLNGAVPKAPFDNWLDEQLSRDPNS |
| Putative thioredoxin-like protein | B | 148 | Yersinia Pestis | SNAMNTVCTACMATNRLPEERIDDGAKCGRCGHSLFDGEVINATAETLDKLLQDDLPMVIDFWAPWCGPCRSFAPIFAETAAERAGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMIDMLNGAVPKAPFDNWLDEQLSRDPNS |
| Putative thioredoxin-like protein | C | 148 | Yersinia Pestis | SNAMNTVCTACMATNRLPEERIDDGAKCGRCGHSLFDGEVINATAETLDKLLQDDLPMVIDFWAPWCGPCRSFAPIFAETAAERAGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMIDMLNGAVPKAPFDNWLDEQLSRDPNS |
| Putative thioredoxin-like protein | D | 148 | Yersinia Pestis | SNAMNTVCTACMATNRLPEERIDDGAKCGRCGHSLFDGEVINATAETLDKLLQDDLPMVIDFWAPWCGPCRSFAPIFAETAAERAGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMIDMLNGAVPKAPFDNWLDEQLSRDPNS |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-10-01 Deposition Author(s): Anderson, W.F. , Center For Structural Genomics Of Infectious Diseases (Csgid) , Grimshaw, S. , Joachimiak, A. , Kim, Y. , Zhou, M.