Mdr769 hiv-1 protease complexed with tf/pr hepta-peptide
PDB DOI: 10.2210/pdb3ou4/pdb
Classification: HYDROLASE/PEPTIDE Organism(s): Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2010-09-14 Deposition Author(s): Brunzelle, J. , Kovari, I.A. , Kovari, L.C. , Liu, Z. , Wang, Y.
Mdr769 hiv-1 protease complexed with tf/pr hepta-peptide
Brunzelle, J. , Kovari, I.A. , Kovari, L.C. , Liu, Z. , Wang, Y.
Primary Citation of Related Structures: 3OU4
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
HIV-1 protease | A | 99 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PQITLWQRPIVTIKIGGQLKEALLNTGADDTVLEEVNLPGRWKPKLIGGIGGFVKVRQYDQVPIEICGHKVIGTVLVGPTPTNVIGRNLMTQIGCTLNF |
HIV-1 protease | B | 99 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PQITLWQRPIVTIKIGGQLKEALLNTGADDTVLEEVNLPGRWKPKLIGGIGGFVKVRQYDQVPIEICGHKTIGTVLVGPTPTNVIGRNLMTQIGCTLNF |
TF/PR substrate peptide | C | 7 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | FNFPQIT |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-09-14 Deposition Author(s): Brunzelle, J. , Kovari, I.A. , Kovari, L.C. , Liu, Z. , Wang, Y.