Crystal structures of multidrug-resistant clinical isolate 769 hiv-1 protease variants
PDB DOI: 10.2210/pdb3oqd/pdb
Classification: HYDROLASE Organism(s): Human Immunodeficiency Virus 1
Deposited: 2010-09-02 Deposition Author(s): Kovari, L.C. , Martin, P.D. , Martinez-Cajas, J.L. , Proteasa, G. , Vickrey, J.F. , Wawrzak, Z. , Yedidi, R.S.
Crystal structures of multidrug-resistant clinical isolate 769 hiv-1 protease variants
Kovari, L.C. , Martin, P.D. , Martinez-Cajas, J.L. , Proteasa, G. , Vickrey, J.F. , Wawrzak, Z. , Yedidi, R.S.
Primary Citation of Related Structures: 3OQD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HIV-1 Protease | A | 99 | Human Immunodeficiency Virus 1 | PQITLWQRPIVTIKIGGQLKEALLNTGADDTVLEEVNLPGRWKPKLIGGIGGFVKVRQYDQVPIEICGHKVIGTVLVGPTPFNVIGRNLMTQIGCTLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-09-02 Deposition Author(s): Kovari, L.C. , Martin, P.D. , Martinez-Cajas, J.L. , Proteasa, G. , Vickrey, J.F. , Wawrzak, Z. , Yedidi, R.S.