Crystal structure of difoil-4p homo-trimer: de novo designed dimeric trefoil-fold sub-domain which forms homo-trimer assembly
PDB DOI: 10.2210/pdb3ogf/pdb
Classification: DE NOVO PROTEIN Organism(s): Synthetic Construct
Deposited: 2010-08-16 Deposition Author(s): Blaber, M. , Lee, J.
Crystal structure of difoil-4p homo-trimer: de novo designed dimeric trefoil-fold sub-domain which forms homo-trimer assembly
Primary Citation of Related Structures: 3OGF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| de novo designed dimeric trefoil-fold sub-domain which forms homo-trimer assembly | A | 90 | Synthetic Construct | HHHHHHPVLLKSTETGQYLRINPDGTVDGTRDRSDPHIQFQISPEGNGEVLLKSTETGQYLRINPDGTVDGTRDRSDPHIQFQISPEGNG |
| de novo designed dimeric trefoil-fold sub-domain which forms homo-trimer assembly | B | 90 | Synthetic Construct | HHHHHHPVLLKSTETGQYLRINPDGTVDGTRDRSDPHIQFQISPEGNGEVLLKSTETGQYLRINPDGTVDGTRDRSDPHIQFQISPEGNG |
| de novo designed dimeric trefoil-fold sub-domain which forms homo-trimer assembly | C | 90 | Synthetic Construct | HHHHHHPVLLKSTETGQYLRINPDGTVDGTRDRSDPHIQFQISPEGNGEVLLKSTETGQYLRINPDGTVDGTRDRSDPHIQFQISPEGNG |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-08-16 Deposition Author(s): Blaber, M. , Lee, J.