Crystal structure of the grb2 sh2 domain in complex with an acyclic ligand having the sequence pyvnvp
PDB DOI: 10.2210/pdb3n8m/pdb
Classification: PROTEIN BINDING/PEPTIDE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2010-05-28 Deposition Author(s): Clements, J.H. , Martin, S.F. , Whiddon, B.B.
Crystal structure of the grb2 sh2 domain in complex with an acyclic ligand having the sequence pyvnvp
Clements, J.H. , Martin, S.F. , Whiddon, B.B.
Primary Citation of Related Structures: 3N8M
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Growth factor receptor-bound protein 2 | A | 117 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQAHHHHHH |
PEPTIDE | B | 6 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XYVNVX |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-05-28 Deposition Author(s): Clements, J.H. , Martin, S.F. , Whiddon, B.B.