Crystal structure of hp67 h41f - p212121
PDB DOI: 10.2210/pdb3myc/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Gallus Gallus
Deposited: 2010-05-10 Deposition Author(s): Brown, J.W. , Farelli, J.D. , Mcknight, C.J.
Crystal structure of hp67 h41f - p212121
Brown, J.W. , Farelli, J.D. , Mcknight, C.J.
Primary Citation of Related Structures: 3MYC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Villin-1 | A | 67 | Gallus Gallus | PTKLETFPLDVLVNTAAEDLPRGVDPSRKENFLSDEDFKAVFGMTRSAFANLPLWKQQNLKKEKGLF |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-05-10 Deposition Author(s): Brown, J.W. , Farelli, J.D. , Mcknight, C.J.