Crystal structure of the nac domain of alpha subunit of nascent polypeptide-associated complex(nac)
PDB DOI: 10.2210/pdb3mce/pdb
Classification: CHAPERONE Organism(s): Salmonella Enterica
Deposited: 2010-03-29 Deposition Author(s): Li, X.M. , Rao, Z. , Wang, L. , Wang, L.F. , Zhang, W.C. , Zhang, X.J.C.
Method: X-RAY DIFFRACTION Resolution: 2.396 Å
Crystal structure of the nac domain of alpha subunit of nascent polypeptide-associated complex(nac)
Li, X.M. , Rao, Z. , Wang, L. , Wang, L.F. , Zhang, W.C. , Zhang, X.J.C.
Primary Citation of Related Structures: 3MCE
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Nascent polypeptide-associated complex subunit alpha | A | 61 | Salmonella Enterica | GPLGSPEFSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLSQ |
Nascent polypeptide-associated complex subunit alpha | B | 61 | Salmonella Enterica | GPLGSPEFSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLSQ |
Nascent polypeptide-associated complex subunit alpha | C | 61 | Salmonella Enterica | GPLGSPEFSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLSQ |
Nascent polypeptide-associated complex subunit alpha | D | 61 | Salmonella Enterica | GPLGSPEFSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLSQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-03-29 Deposition Author(s): Li, X.M. , Rao, Z. , Wang, L. , Wang, L.F. , Zhang, W.C. , Zhang, X.J.C.