Structure of aristaless homeodomain in complex with dna
PDB DOI: 10.2210/pdb3lnq/pdb
Classification: Gene Regulation/DNA Organism(s): Drosophila Melanogaster , Synthetic Construct
Deposited: 2010-02-02 Deposition Author(s): Kojima, T. , Miyazono, K. , Nagata, K. , Saigo, K. , Takamura, Y. , Tanokura, M.
Structure of aristaless homeodomain in complex with dna
Kojima, T. , Miyazono, K. , Nagata, K. , Saigo, K. , Takamura, Y. , Tanokura, M.
Primary Citation of Related Structures: 3LNQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Homeobox protein aristaless | A | 58 | Drosophila Melanogaster , Synthetic Construct | RYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQE |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-02-02 Deposition Author(s): Kojima, T. , Miyazono, K. , Nagata, K. , Saigo, K. , Takamura, Y. , Tanokura, M.