Crystal structure of response regulator receiver protein from pseudoalteromonas atlantica
PDB DOI: 10.2210/pdb3kto/pdb
Classification: transcription regulator Organism(s): Pseudoalteromonas Atlantica T6C
Deposited: 2009-11-25 Deposition Author(s): Burley, S.K. , Damodharan, L. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Swaminathan, S.
Crystal structure of response regulator receiver protein from pseudoalteromonas atlantica
Burley, S.K. , Damodharan, L. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Swaminathan, S.
Primary Citation of Related Structures: 3KTO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Response regulator receiver protein | A | 136 | Pseudoalteromonas Atlantica T6C | MSLNHHPIIYLVDHQKDARAALSKLLSPLDVTIQCFASAESFMRQQISDDAIGMIIEAHLEDKKDSGIELLETLVKRGFHLPTIVMASSSDIPTAVRAMRASAADFIEKPFIEHVLVHDVQQIINGAKEGHHHHHH |
| Response regulator receiver protein | B | 136 | Pseudoalteromonas Atlantica T6C | MSLNHHPIIYLVDHQKDARAALSKLLSPLDVTIQCFASAESFMRQQISDDAIGMIIEAHLEDKKDSGIELLETLVKRGFHLPTIVMASSSDIPTAVRAMRASAADFIEKPFIEHVLVHDVQQIINGAKEGHHHHHH |
| Response regulator receiver protein | C | 136 | Pseudoalteromonas Atlantica T6C | MSLNHHPIIYLVDHQKDARAALSKLLSPLDVTIQCFASAESFMRQQISDDAIGMIIEAHLEDKKDSGIELLETLVKRGFHLPTIVMASSSDIPTAVRAMRASAADFIEKPFIEHVLVHDVQQIINGAKEGHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-11-25 Deposition Author(s): Burley, S.K. , Damodharan, L. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Swaminathan, S.