Crystal structure of the human gst pi c47s/y108v double mutant in complex with the ethacrynic acid-glutathione conjugate (grown in the absence of the reducing agent dtt)
PDB DOI: 10.2210/pdb3kmo/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens
Deposited: 2009-11-11 Deposition Author(s): Parker, L.J.
Method: X-RAY DIFFRACTION Resolution: 2.6 Å
Crystal structure of the human gst pi c47s/y108v double mutant in complex with the ethacrynic acid-glutathione conjugate (grown in the absence of the reducing agent dtt)
Primary Citation of Related Structures: 3KMO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Glutathione S-transferase P | A | 209 | Homo Sapiens | PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASSLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIVTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ |
| Glutathione S-transferase P | B | 209 | Homo Sapiens | PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASSLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIVTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-11-11 Deposition Author(s): Parker, L.J.