Crystal structure of the thap domain from d. melanogaster p-element transposase in complex with its natural dna binding site
PDB DOI: 10.2210/pdb3kde/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Drosophila Melanogaster , Synthetic Construct
Deposited: 2009-10-22 Deposition Author(s): Berger, J.M. , Lyubimov, A.Y. , Rio, D.C. , Sabogal, A.
Crystal structure of the thap domain from d. melanogaster p-element transposase in complex with its natural dna binding site
Berger, J.M. , Lyubimov, A.Y. , Rio, D.C. , Sabogal, A.
Primary Citation of Related Structures: 3KDE
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transposable element P transposase | C | 77 | Drosophila Melanogaster , Synthetic Construct | MKYCKFCCKAVTGVKLIHVPKCAIKRKLWEQSLGCSLGENSQICDTHFNDSQWKAAPAKGQTFKRRRLNADAVPSKV |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-10-22 Deposition Author(s): Berger, J.M. , Lyubimov, A.Y. , Rio, D.C. , Sabogal, A.