Crystal structure of the p22 c2 repressor protein in complex with synthetic operator 9c in the presence of rb+
PDB DOI: 10.2210/pdb3jxd/pdb
Classification: TRANSCRIPTION REGULATOR Organism(s): Enterobacteria Phage P22 , Synthetic Construct
Deposited: 2009-09-18 Deposition Author(s): Koudelka, G.B. , Watkins, D. , Williams, L.D.
Method: X-RAY DIFFRACTION Resolution: 2.1 Å
Crystal structure of the p22 c2 repressor protein in complex with synthetic operator 9c in the presence of rb+
Koudelka, G.B. , Watkins, D. , Williams, L.D.
Primary Citation of Related Structures: 3JXD
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Repressor protein C2 | L | 67 | Enterobacteria Phage P22 , Synthetic Construct | NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLLKGD |
Repressor protein C2 | R | 67 | Enterobacteria Phage P22 , Synthetic Construct | NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLLKGD |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-09-18 Deposition Author(s): Koudelka, G.B. , Watkins, D. , Williams, L.D.