Crystal structure of a z-z junction (with hepes intercalating)
PDB DOI: 10.2210/pdb3irr/pdb
Classification: HYDROLASE/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2009-08-24 Deposition Author(s): Athanasiadis, A. , De Rosa, M.
Crystal structure of a z-z junction (with hepes intercalating)
Athanasiadis, A. , De Rosa, M.
Primary Citation of Related Structures: 3IRR
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Double-stranded RNA-specific adenosine deaminase | A | 67 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHMEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAVSTQ |
Double-stranded RNA-specific adenosine deaminase | B | 67 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHMEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAVSTQ |
Double-stranded RNA-specific adenosine deaminase | C | 67 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHMEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAVSTQ |
Double-stranded RNA-specific adenosine deaminase | D | 67 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHMEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAVSTQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-08-24 Deposition Author(s): Athanasiadis, A. , De Rosa, M.