Crystal structure of pka ri alpha dimerization/docking domain
PDB DOI: 10.2210/pdb3im3/pdb
Classification: STRUCTURAL PROTEIN, SIGNALING PROTEIN Organism(s): Bos Taurus
Deposited: 2009-08-09 Deposition Author(s): Kim, C. , Kinderman, F.S. , Sarma, G.N. , Taylor, S.S. , Von Daake, S.
Crystal structure of pka ri alpha dimerization/docking domain
Kim, C. , Kinderman, F.S. , Sarma, G.N. , Taylor, S.S. , Von Daake, S.
Primary Citation of Related Structures: 3IM3
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
cAMP-dependent protein kinase type I-alpha regulatory subunit | A | 50 | Bos Taurus | SLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFEKLEKEEAK |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-08-09 Deposition Author(s): Kim, C. , Kinderman, F.S. , Sarma, G.N. , Taylor, S.S. , Von Daake, S.