Crystal structure of human chromobox homolog 6 (cbx6) with h3k27 peptide
PDB DOI: 10.2210/pdb3i90/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2009-07-10 Deposition Author(s): Amaya, M.F. , Arrowsmith, C.H. , Bochkarev, A. , Bountra, C. , Edwards, A.M. , Kozieradzki, I. , Loppnau, P. , Min, J. , Ouyang, H. , Ravichandran, M. , Structural Genomics Consortium (Sgc) , Weigelt, J.
Crystal structure of human chromobox homolog 6 (cbx6) with h3k27 peptide
Amaya, M.F. , Arrowsmith, C.H. , Bochkarev, A. , Bountra, C. , Edwards, A.M. , Kozieradzki, I. , Loppnau, P. , Min, J. , Ouyang, H. , Ravichandran, M. , Structural Genomics Consortium (Sgc) , Weigelt, J.
Primary Citation of Related Structures: 3I90
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chromobox protein homolog 6 | A | 51 | Homo Sapiens , Synthetic Construct | RVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQ |
| Chromobox protein homolog 6 | B | 51 | Homo Sapiens , Synthetic Construct | RVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQ |
| H3K27 peptide | C | 11 | Homo Sapiens , Synthetic Construct | QLATKAARKSA |
| H3K27 peptide | D | 11 | Homo Sapiens , Synthetic Construct | QLATKAARKSA |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-07-10 Deposition Author(s): Amaya, M.F. , Arrowsmith, C.H. , Bochkarev, A. , Bountra, C. , Edwards, A.M. , Kozieradzki, I. , Loppnau, P. , Min, J. , Ouyang, H. , Ravichandran, M. , Structural Genomics Consortium (Sgc) , Weigelt, J.