The pairing geometry of the hydrophobic thymine analog 2,4-difluorotoluene in duplex dna as analyzed by x-ray crystallography
PDB DOI: 10.2210/pdb3i8d/pdb
Classification: HYDROLASE/DNA Organism(s): Streptomyces Nogalater , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2009-07-09 Deposition Author(s): Egli, M. , Pallan, P.S.
The pairing geometry of the hydrophobic thymine analog 2,4-difluorotoluene in duplex dna as analyzed by x-ray crystallography
Primary Citation of Related Structures: 3I8D
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Ribonuclease H | A | 132 | Streptomyces Nogalater , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADY |
Ribonuclease H | C | 132 | Streptomyces Nogalater , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADY |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-07-09 Deposition Author(s): Egli, M. , Pallan, P.S.