Pi3k sh3 domain in complex with a peptide ligand
PDB DOI: 10.2210/pdb3i5r/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2009-07-06 Deposition Author(s): Batra-Safferling, R. , Granzin, J. , Hoffmann, S. , Modder, S. , Willbold, D.
Pi3k sh3 domain in complex with a peptide ligand
Batra-Safferling, R. , Granzin, J. , Hoffmann, S. , Modder, S. , Willbold, D.
Primary Citation of Related Structures: 3I5R
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Phosphatidylinositol 3-kinase regulatory subunit alpha | A | 83 | Homo Sapiens , Synthetic Construct | MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKIS |
Peptide ligand | B | 12 | Homo Sapiens , Synthetic Construct | HSKRPLPPLPSL |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-07-06 Deposition Author(s): Batra-Safferling, R. , Granzin, J. , Hoffmann, S. , Modder, S. , Willbold, D.