3I5R
Pi3k sh3 domain in complex with a peptide ligand
PDB DOI: 10.2210/pdb3i5r/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2009-07-06 Deposition Author(s): Batra-Safferling, R. , Granzin, J. , Hoffmann, S. , Modder, S. , Willbold, D.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.7 Å
Pi3k sh3 domain in complex with a peptide ligand
Batra-Safferling, R. , Granzin, J. , Hoffmann, S. , Modder, S. , Willbold, D.
Primary Citation of Related Structures: 3I5R
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Phosphatidylinositol 3-kinase regulatory subunit alpha | A | 83 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKIS |
| Peptide ligand | B | 12 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | HSKRPLPPLPSL |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2009-07-06 Deposition Author(s): Batra-Safferling, R. , Granzin, J. , Hoffmann, S. , Modder, S. , Willbold, D.