Structure of the apo form of leucoanthocyanidin reductase from vitis vinifera
PDB DOI: 10.2210/pdb3i5m/pdb
Classification: OXIDOREDUCTASE Organism(s): Vitis Vinifera
Deposited: 2009-07-06 Deposition Author(s): D'Estaintot, B.L. , Gallois, B. , Gargouri, M. , Granier, T. , Mauge, C.
Structure of the apo form of leucoanthocyanidin reductase from vitis vinifera
D'Estaintot, B.L. , Gallois, B. , Gargouri, M. , Granier, T. , Mauge, C.
Primary Citation of Related Structures: 3I5M
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Putative leucoanthocyanidin reductase 1 | A | 346 | Vitis Vinifera | MTVSPVPSPKGRVLIAGATGFIGQFVATASLDAHRPTYILARPGPRSPSKAKIFKALEDKGAIIVYGLINEQEAMEKILKEHEIDIVVSTVGGESILDQIALVKAMKAVGTIKRFLPSEFGHDVNRADPVEPGLNMYREKRRVRQLVEESGIPFTYICCNSIASWPYYNNIHPSEVLPPTDFFQIYGDGNVKAYFVAGTDIGKFTMKTVDDVRTLNKSVHFRPSCNCLNINELASVWEKKIGRTLPRVTVTEDDLLAAAGENIIPQSVVAAFTHDIFIKGCQVNFSIDGPEDVEVTTLYPEDSFRTVEECFGEYIVKMEEKQPTADSAIANTGPVVGMRQVTATCA |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-07-06 Deposition Author(s): D'Estaintot, B.L. , Gallois, B. , Gargouri, M. , Granier, T. , Mauge, C.